OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ADO (NM_032804) Human Mass Spec Standard

Be the first to review this product
SKU
PH305583
ADO MS Standard C13 and N15-labeled recombinant protein (NP_116193)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322128 Anti-ADO Rabbit Polyclonal Antibody
100 ul
$305.00
LY409931 Transient overexpression lysate of 2-aminoethanethiol (cysteamine) dioxygenase (ADO) (as WB positive control) 100 ug
$436.00

Other products for "ADO or NM_032804"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205583
Predicted MW 29.9 kDa
Protein Sequence
Protein Sequence
>RC205583 protein sequence
Red=Cloning site Green=Tags(s)

MPRDNMASLIQRIARQACLTFRGSWGGRGASDRDAASGAEAPMQPGFPENLSKLKSLLTQLRAEDLNIAP
RKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAGG
GQRPRALPPEQQFEPPLQPREREAVRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAP
PYDPDDGRDCHYYRVLEPVRPKEASSSACDLPREVWLLETPQADDFWCEGEPYPGPKVFP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116193
RefSeq Size 3739
RefSeq ORF 810
Synonyms C10orf22
Locus ID 84890
UniProt ID Q96SZ5
Cytogenetics 10q21.3
Summary Human thiol dioxygenases include cysteine dioxygenase (CDO; MIM 603943) and cysteamine (2-aminoethanethiol) dioxygenase (ADO; EC 1.13.11.19). CDO adds 2 oxygen atoms to free cysteine, whereas ADO adds 2 oxygen atoms to free cysteamine to form hypotaurine (Dominy et al., 2007 PubMed 17581819).supplied by OMIM, Mar 2008
Protein Pathways Metabolic pathways, Taurine and hypotaurine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ADO" proteins (3)
SKU Description Size Price
LC409931 Lyophilized ADO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409931 Transient overexpression lysate of 2-aminoethanethiol (cysteamine) dioxygenase (ADO) (as WB positive control) 100 ug
$436.00
TP305583 Recombinant protein of human 2-aminoethanethiol (cysteamine) dioxygenase (ADO), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products