OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GEM (NM_181702) Human Mass Spec Standard

Be the first to review this product
SKU
PH305286
GEM MS Standard C13 and N15-labeled recombinant protein (NP_859053)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA346399 Rabbit Polyclonal Anti-GEM Antibody
100 ul
$525.00
LY401618 Transient overexpression lysate of GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "GEM or NM_181702"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205286
Predicted MW 33.9 kDa
Protein Sequence
Protein Sequence
>RC205286 protein sequence
Red=Cloning site Green=Tags(s)

MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSE
SGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENE
WLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACA
VVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKN
MAFKLKSKSCHDLSVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_859053
RefSeq Size 2080
RefSeq ORF 888
Synonyms KIR
Locus ID 2669
UniProt ID P55040
Cytogenetics 8q22.1
Summary The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GEM" proteins (7)
SKU Description Size Price
PH323722 GEM MS Standard C13 and N15-labeled recombinant protein (NP_005252) 10 ug
$3,360.00
LC401618 Lyophilized GEM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405649 Lyophilized GEM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401618 Transient overexpression lysate of GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY405649 Transient overexpression lysate of GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP305286 Recombinant protein of human GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 2, 20 µg 20 ug
$867.00
TP323722 Recombinant protein of human GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products