GEM (NM_005261) Human Mass Spec Standard

SKU
PH323722
GEM MS Standard C13 and N15-labeled recombinant protein (NP_005252)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223722]
Predicted MW 33.8 kDa
Protein Sequence
Protein Sequence
>RC223722 representing NM_005261
Red=Cloning site Green=Tags(s)

MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSE
SGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENE
WLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACA
VVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKN
MAFKLKSKSCHDLSVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005252
RefSeq Size 2205
RefSeq ORF 888
Synonyms KIR
Locus ID 2669
UniProt ID P55040
Cytogenetics 8q22.1
Summary The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:GEM (NM_005261) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH305286 GEM MS Standard C13 and N15-labeled recombinant protein (NP_859053) 10 ug
$3,255.00
LC401618 GEM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405649 GEM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401618 Transient overexpression lysate of GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1 100 ug
$436.00
LY405649 Transient overexpression lysate of GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 2 100 ug
$436.00
TP305286 Recombinant protein of human GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323722 Recombinant protein of human GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.