GEM (NM_005261) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC223722] |
Predicted MW | 33.8 kDa |
Protein Sequence |
Protein Sequence
>RC223722 representing NM_005261
Red=Cloning site Green=Tags(s) MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSE SGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENE WLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACA VVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKN MAFKLKSKSCHDLSVL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_005252 |
RefSeq Size | 2205 |
RefSeq ORF | 888 |
Synonyms | KIR |
Locus ID | 2669 |
UniProt ID | P55040 |
Cytogenetics | 8q22.1 |
Summary | The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH305286 | GEM MS Standard C13 and N15-labeled recombinant protein (NP_859053) | 10 ug |
$3,255.00
|
|
LC401618 | GEM HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC405649 | GEM HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401618 | Transient overexpression lysate of GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1 | 100 ug |
$436.00
|
|
LY405649 | Transient overexpression lysate of GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 2 | 100 ug |
$436.00
|
|
TP305286 | Recombinant protein of human GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP323722 | Recombinant protein of human GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.