OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PHPT1 (NM_014172) Human Mass Spec Standard

Be the first to review this product
SKU
PH305124
PHPT1 MS Standard C13 and N15-labeled recombinant protein (NP_054891)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA366351 PHPT1 rabbit polyclonal antibody
100 ul
$310.00
LY415462 Transient overexpression lysate of phosphohistidine phosphatase 1 (PHPT1), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "PHPT1 or NM_014172"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205124
Predicted MW 13.8 kDa
Protein Sequence
Protein Sequence
>RC205124 protein sequence
Red=Cloning site Green=Tags(s)

MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCD
CECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054891
RefSeq Size 1199
RefSeq ORF 375
Synonyms CGI-202; HEL-S-132P; HSPC141; PHP; PHP14
Locus ID 29085
UniProt ID Q9NRX4
Cytogenetics 9q34.3
Summary This gene encodes an enzyme that catalyzes the reversible dephosphorylation of histidine residues in proteins. It may be involved in the dephosphorylation of G-beta and ATP citrate lyase and in negatively regulating CD4 T lymphocytes by dephosphorylation and inhibition of KCa3.1 channels. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2013
Protein Families Druggable Genome
Protein Pathways Fructose and mannose metabolism, Metabolic pathways, Riboflavin metabolism, Thiamine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PHPT1" proteins (3)
SKU Description Size Price
LC415462 Lyophilized PHPT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415462 Transient overexpression lysate of phosphohistidine phosphatase 1 (PHPT1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP305124 Recombinant protein of human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products