OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMIGD2 (NM_144615) Human Mass Spec Standard

Be the first to review this product
SKU
PH304938
TMIGD2 MS Standard C13 and N15-labeled recombinant protein (NP_653216)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA326695 Rabbit Polyclonal TMIGD2 Antibody
100 ug
$640.00
LY408250 Transient overexpression lysate of transmembrane and immunoglobulin domain containing 2 (TMIGD2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TMIGD2 or NM_144615"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204938
Predicted MW 30.7 kDa
Protein Sequence
Protein Sequence
>RC204938 protein sequence
Red=Cloning site Green=Tags(s)

MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPY
ITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQ
NRNRIASFPGFLFVLLGVGSMGVAAIVWGAWFWGRRSCQQRDSGNSPGNAFYSNVLYRPRGPPKKSEDCS
GEGKDQRGQSIYSTSFPQPAPRQPHLASRPCPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVG
EE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_653216
RefSeq Size 1282
RefSeq ORF 846
Synonyms CD28H; IGPR-1; IGPR1
Locus ID 126259
UniProt ID Q96BF3
Cytogenetics 19p13.3
Summary Plays a role in cell-cell interaction, cell migration, and angiogenesis. Through interaction with HHLA2, costimulates T-cells in the context of TCR-mediated activation. Enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMIGD2" proteins (6)
SKU Description Size Price
LC408250 Lyophilized TMIGD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432814 Lyophilized TMIGD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408250 Transient overexpression lysate of transmembrane and immunoglobulin domain containing 2 (TMIGD2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY432814 Transient overexpression lysate of transmembrane and immunoglobulin domain containing 2 (TMIGD2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP304938 Recombinant protein of human transmembrane and immunoglobulin domain containing 2 (TMIGD2), 20 µg 20 ug
$737.00
TP329814 Purified recombinant protein of Homo sapiens transmembrane and immunoglobulin domain containing 2 (TMIGD2), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products