OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

USF1 (NM_007122) Human Mass Spec Standard

Be the first to review this product
SKU
PH304915
USF1 MS Standard C13 and N15-labeled recombinant protein (NP_009053)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA324374 USF1 Antibody (Center)
400 ul
$645.00
LY404129 Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "USF1 or NM_007122"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204915
Predicted MW 33.5 kDa
Protein Sequence
Protein Sequence
>RC204915 protein sequence
Red=Cloning site Green=Tags(s)

MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQ
LDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVV
TTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVERR
RRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQ
QVEDLKNKNLLLRAQLRHHGLEVVIKNDSN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009053
RefSeq Size 1830
RefSeq ORF 930
Synonyms bHLHb11; FCHL; FCHL1; HYPLIP1; MLTF; MLTFI; UEF
Locus ID 7391
UniProt ID P22415
Cytogenetics 1q23.3
Summary This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL). Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been defined on chromosome 21. provided by RefSeq, Feb 2013
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "USF1" proteins (7)
SKU Description Size Price
PH319106 USF1 MS Standard C13 and N15-labeled recombinant protein (NP_996888) 10 ug
$3,360.00
LC404129 Lyophilized USF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416182 Lyophilized USF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404129 Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY416182 Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP304915 Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 1, 20 µg 20 ug
$737.00
TP319106 Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products