USF1 (NM_007122) Human Recombinant Protein

SKU
TP304915
Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204915 protein sequence
Red=Cloning site Green=Tags(s)

MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQ
LDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVV
TTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVERR
RRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQ
QVEDLKNKNLLLRAQLRHHGLEVVIKNDSN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_009053
Locus ID 7391
UniProt ID P22415
Cytogenetics 1q23.3
RefSeq Size 1830
RefSeq ORF 930
Synonyms bHLHb11; FCHL; FCHL1; HYPLIP1; MLTF; MLTFI; UEF
Summary This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL). Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been defined on chromosome 21. [provided by RefSeq, Feb 2013]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:USF1 (NM_007122) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304915 USF1 MS Standard C13 and N15-labeled recombinant protein (NP_009053) 10 ug
$3,255.00
PH319106 USF1 MS Standard C13 and N15-labeled recombinant protein (NP_996888) 10 ug
$3,255.00
LC404129 USF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416182 USF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404129 Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 2 100 ug
$436.00
LY416182 Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 1 100 ug
$436.00
TP319106 Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.