USF1 (NM_007122) Human Mass Spec Standard

SKU
PH304915
USF1 MS Standard C13 and N15-labeled recombinant protein (NP_009053)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204915]
Predicted MW 33.5 kDa
Protein Sequence
Protein Sequence
>RC204915 protein sequence
Red=Cloning site Green=Tags(s)

MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQ
LDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVV
TTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVERR
RRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQ
QVEDLKNKNLLLRAQLRHHGLEVVIKNDSN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009053
RefSeq Size 1830
RefSeq ORF 930
Synonyms bHLHb11; FCHL; FCHL1; HYPLIP1; MLTF; MLTFI; UEF
Locus ID 7391
UniProt ID P22415
Cytogenetics 1q23.3
Summary This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL). Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been defined on chromosome 21. [provided by RefSeq, Feb 2013]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:USF1 (NM_007122) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH319106 USF1 MS Standard C13 and N15-labeled recombinant protein (NP_996888) 10 ug
$3,255.00
LC404129 USF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416182 USF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404129 Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 2 100 ug
$436.00
LY416182 Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 1 100 ug
$436.00
TP304915 Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 1, 20 µg 20 ug
$737.00
TP319106 Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.