OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CLIC2 (NM_001289) Human Mass Spec Standard

Be the first to review this product
SKU
PH304727
CLIC2 MS Standard C13 and N15-labeled recombinant protein (NP_001280)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY420025 Transient overexpression lysate of chloride intracellular channel 2 (CLIC2) (as WB positive control) 100 ug
$436.00

Other products for "CLIC2 or NM_001289"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204727
Predicted MW 28.4 kDa
Protein Sequence
Protein Sequence
>RC204727 protein sequence
Red=Cloning site Green=Tags(s)

MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNP
PFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLL
KEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFS
GVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001280
RefSeq Size 2694
RefSeq ORF 741
Synonyms CLCNL2; CLIC2b; MRXS32; XAP121
Locus ID 1193
UniProt ID O15247
Cytogenetics Xq28
Summary This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. This protein plays a role in inhibiting the function of ryanodine receptor 2. A mutation in this gene is the cause of an X-linked form of cognitive disability. provided by RefSeq, Jul 2017
Protein Families Druggable Genome, Ion Channels: Other
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CLIC2" proteins (4)
SKU Description Size Price
LC420025 Lyophilized CLIC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420025 Transient overexpression lysate of chloride intracellular channel 2 (CLIC2) (as WB positive control) 100 ug
$436.00
TP304727 Recombinant protein of human chloride intracellular channel 2 (CLIC2), 20 µg 20 ug
$737.00
TP720238 Recombinant protein of human chloride intracellular channel 2 (CLIC2) 10 ug
$330.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products