OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RRAS2 (NM_012250) Human Mass Spec Standard

Be the first to review this product
SKU
PH304591
RRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_036382)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308124 Rabbit Polyclonal antibody to TC21 (related RAS viral (r-ras) oncogene homolog 2)
100 ul
$665.00
LY415877 Transient overexpression lysate of related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "RRAS2 or NM_012250"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204591
Predicted MW 23.4 kDa
Protein Sequence
Protein Sequence
>RC204591 protein sequence
Red=Cloning site Green=Tags(s)

MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTA
GQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQE
EGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036382
RefSeq Size 2360
RefSeq ORF 612
Synonyms NS12; TC21
Locus ID 22800
UniProt ID P62070
Cytogenetics 11p15.2
Summary This gene encodes a member of the R-Ras subfamily of Ras-like small GTPases. The encoded protein associates with the plasma membrane and may function as a signal transducer. This protein may play an important role in activating signal transduction pathways that control cell proliferation. Mutations in this gene are associated with the growth of certain tumors. Pseudogenes of this gene are found on chromosomes 1 and 2. Alternate splicing results in multiple transcript variants. provided by RefSeq, Apr 2010
Protein Families Druggable Genome
Protein Pathways MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RRAS2" proteins (3)
SKU Description Size Price
LC415877 Lyophilized RRAS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415877 Transient overexpression lysate of related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP304591 Recombinant protein of human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products