OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MRGPRF (NM_145015) Human Mass Spec Standard

Be the first to review this product
SKU
PH304556
MRGPRF MS Standard C13 and N15-labeled recombinant protein (NP_659452)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA340640 Rabbit Polyclonal Anti-MRGPRF Antibody (C-Terminus)
50 ug
$550.00
LY403413 Transient overexpression lysate of MAS-related GPR, member F (MRGPRF), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "MRGPRF or NM_145015"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204556
Predicted MW 38.2 kDa
Protein Sequence
Protein Sequence
>RC204556 protein sequence
Red=Cloning site Green=Tags(s)

MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFG
FSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAE
RCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIFLGILLFLLCC
PLMVLPCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCI
CINSSAKPIVYFLAGRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_659452
RefSeq Size 2308
RefSeq ORF 1029
Synonyms GPR140; GPR168; MRGF; RTA
Locus ID 116535
UniProt ID Q96AM1
Cytogenetics 11q13.3
Summary Orphan receptor. May bind to a neuropeptide and may regulate nociceptor function and/or development, including the sensation or modulation of pain (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MRGPRF" proteins (5)
SKU Description Size Price
LC403413 Lyophilized MRGPRF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420613 Lyophilized MRGPRF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403413 Transient overexpression lysate of MAS-related GPR, member F (MRGPRF), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420613 Transient overexpression lysate of MAS-related GPR, member F (MRGPRF), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP304556 Recombinant protein of human MAS-related GPR, member F (MRGPRF), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products