OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HEXIM2 (NM_144608) Human Mass Spec Standard

Be the first to review this product
SKU
PH304552
HEXIM2 MS Standard C13 and N15-labeled recombinant protein (NP_653209)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY403395 Transient overexpression lysate of hexamthylene bis-acetamide inducible 2 (HEXIM2) (as WB positive control) 100 ug
$436.00

Other products for "HEXIM2 or NM_144608"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204552
Predicted MW 32.4 kDa
Protein Sequence
Protein Sequence
>RC204552 protein sequence
Red=Cloning site Green=Tags(s)

MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGAVGGLGWNSR
SPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAP
YNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSK
QELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRC
DEEPGT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_653209
RefSeq Size 1330
RefSeq ORF 858
Synonyms L3
Locus ID 124790
UniProt ID Q96MH2
Cytogenetics 17q21.31
Summary This gene encodes a member of the HEXIM family of proteins. This protein is a component of the 7SK small nuclear ribonucleoprotein. This protein has been found to negatively regulate the kinase activity of the cyclin-dependent kinase P-TEFb, which phosphorylates multiple target proteins to promote transcriptional elongation. This gene is located approximately 7 kb downstream from related family member HEXIM1 on chromosome 17. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jan 2015
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HEXIM2" proteins (3)
SKU Description Size Price
LC403395 Lyophilized HEXIM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403395 Transient overexpression lysate of hexamthylene bis-acetamide inducible 2 (HEXIM2) (as WB positive control) 100 ug
$436.00
TP304552 Recombinant protein of human hexamthylene bis-acetamide inducible 2 (HEXIM2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products