HEXIM2 (NM_144608) Human Tagged ORF Clone

SKU
RC204552
HEXIM2 (Myc-DDK-tagged)-Human hexamthylene bis-acetamide inducible 2 (HEXIM2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HEXIM2
Synonyms L3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204552 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGCCACTCCGAACCAGACCGCCTGTAATGCAGAGTCACCAGTGGCCCTGGAGGAGGCCAAGACCT
CTGGTGCCCCGGGGAGCCCCCAAACACCCCCTGAGCGTCATGACTCTGGTGGTTCCCTGCCCCTGACACC
GCGGATGGAGAGCCACTCAGAGGATGAAGATCTTGCTGGGGCTGTCGGTGGCCTGGGCTGGAACAGTAGG
AGTCCCCGGACCCAGAGCCCAGGGGGCTGCTCAGCGGAGGCTGTGCTGGCCCGGAAGAAACACCGTCGGC
GGCCATCGAAGCGCAAAAGGCACTGGCGACCCTACCTGGAGCTGAGCTGGGCTGAGAAACAACAGCGGGA
TGAGAGGCAGAGCCAGAGGGCCTCCCGGGTCCGCGAAGAGATGTTCGCCAAAGGCCAGCCCGTGGCCCCC
TACAACACCACCCAGTTCCTGATGAATGACAGGGACCCGGAGGAGCCCAACTTGGATGTGCCCCATGGGA
TCTCCCACCCAGGTTCCAGTGGGGAGAGTGAGGCCGGGGACAGTGATGGGCGGGGCCGAGCGCACGGTGA
GTTCCAGCGGAAGGACTTCTCTGAGACTTACGAACGCTTCCACACCGAGAGCCTGCAGGGCCGCAGCAAG
CAGGAGCTGGTGCGAGACTACCTGGAGCTGGAGAAGCGGCTGTCGCAGGCGGAGGAGGAGACTAGGAGGC
TGCAGCAGCTGCAGGCGTGCACCGGCCAGCAGTCCTGCCGCCAGGTGGAGGAGCTGGCTGCCGAGGTCCA
GAGGCTCCGGACCGAAAACCAGCGGCTTCGTCAGGAGAACCAGATGTGGAACCGAGAGGGCTGCCGCTGT
GATGAGGAGCCGGGTACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204552 protein sequence
Red=Cloning site Green=Tags(s)

MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGAVGGLGWNSR
SPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAP
YNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSK
QELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRC
DEEPGT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_144608
ORF Size 858 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_144608.2
RefSeq Size 1330 bp
RefSeq ORF 861 bp
Locus ID 124790
UniProt ID Q96MH2
Cytogenetics 17q21.31
Protein Families Transcription Factors
MW 32.4 kDa
Summary This gene encodes a member of the HEXIM family of proteins. This protein is a component of the 7SK small nuclear ribonucleoprotein. This protein has been found to negatively regulate the kinase activity of the cyclin-dependent kinase P-TEFb, which phosphorylates multiple target proteins to promote transcriptional elongation. This gene is located approximately 7 kb downstream from related family member HEXIM1 on chromosome 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]
Write Your Own Review
You're reviewing:HEXIM2 (NM_144608) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204552L1 Lenti ORF clone of Human hexamthylene bis-acetamide inducible 2 (HEXIM2), Myc-DDK-tagged 10 ug
$600.00
RC204552L2 Lenti ORF clone of Human hexamthylene bis-acetamide inducible 2 (HEXIM2), mGFP tagged 10 ug
$600.00
RC204552L3 Lenti ORF clone of Human hexamthylene bis-acetamide inducible 2 (HEXIM2), Myc-DDK-tagged 10 ug
$600.00
RC204552L4 Lenti ORF clone of Human hexamthylene bis-acetamide inducible 2 (HEXIM2), mGFP tagged 10 ug
$600.00
RG204552 HEXIM2 (tGFP-tagged) - Human hexamthylene bis-acetamide inducible 2 (HEXIM2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC120749 HEXIM2 (untagged)-Human hexamthylene bis-acetamide inducible 2 (HEXIM2) 10 ug
$300.00
SC324352 HEXIM2 (untagged)-Human hexamthylene bis-acetamide inducible 2 (HEXIM2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.