OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ATCAY (NM_033064) Human Mass Spec Standard

Be the first to review this product
SKU
PH304515
ATCAY MS Standard C13 and N15-labeled recombinant protein (NP_149053)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343082 Rabbit Polyclonal Anti-ATCAY Antibody
100 ul
$585.00
LY409774 Transient overexpression lysate of ataxia, cerebellar, Cayman type (ATCAY) (as WB positive control) 100 ug
$436.00

Other products for "ATCAY or NM_033064"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204515
Predicted MW 42.1 kDa
Protein Sequence
Protein Sequence
>RC204515 protein sequence
Red=Cloning site Green=Tags(s)

MGTTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEINI
SLDQSEGSLLSDDFLDTPDDLDINVDDIETPDETDSLEFLGNGNELEWEDDTPVATAKNMPGDSADLFGD
GTTEDGSAANGRLWRTVIIGEQEHRIDLHMIRPYMKVVTHGGYYGEGLNAIIVFAACFLPDSSLPDYHYI
MENLFLYVISSLELLVAEDYMIVYLNGATPRRRMPGIGWLKKCYQMIDRRLRKNLKSLIIVHPSWFIRTV
LAISRPFISVKFINKIQYVHSLEDLEQLIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKP
EVAPVENRSALVSEDQETSMS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_149053
RefSeq Size 5049
RefSeq ORF 1113
Synonyms BNIP-H; CLAC
Locus ID 85300
UniProt ID Q86WG3
Cytogenetics 19p13.3
Summary This gene encodes a neuron-restricted protein that contains a CRAL-TRIO motif common to proteins that bind small lipophilic molecules. Mutations in this gene are associated with cerebellar ataxia, Cayman type. provided by RefSeq, Jul 2008
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ATCAY" proteins (3)
SKU Description Size Price
LC409774 Lyophilized ATCAY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409774 Transient overexpression lysate of ataxia, cerebellar, Cayman type (ATCAY) (as WB positive control) 100 ug
$436.00
TP304515 Recombinant protein of human ataxia, cerebellar, Cayman type (ATCAY), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products