ATCAY Rabbit Polyclonal Antibody

SKU TA343082

Rabbit Polyclonal Anti-ATCAY Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATCAY antibody is: synthetic peptide directed towards the C-terminal region of Human ATCAY. Synthetic peptide located within the following region: LQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVENRSALVSEDQETSM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: ataxia, cerebellar, Cayman type
• Database Link:
  NP_149053
  Q86WG3
• Background: This gene encodes a neuron-restricted protein that contains a CRAL-TRIO motif common to proteins that bind small lipophilic molecules. Mutations in this gene are associated with cerebellar ataxia, Cayman type.
• Synonyms: BNIP-H; CLAC
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Transmembrane