OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RND3 (NM_005168) Human Mass Spec Standard

Be the first to review this product
SKU
PH304479
RND3 MS Standard C13 and N15-labeled recombinant protein (NP_005159)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA369322 RND3 rabbit polyclonal antibody
100 ul
$310.00
LY417471 Transient overexpression lysate of Rho family GTPase 3 (RND3) (as WB positive control) 100 ug
$436.00

Other products for "RND3 or NM_005168"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204479
Predicted MW 27.4 kDa
Protein Sequence
Protein Sequence
>RC204479 protein sequence
Red=Cloning site Green=Tags(s)

MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQR
IELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLR
TDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRNKS
QRATKRISHMPSRPELSAVATDLRKDKAKSCTVM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005159
RefSeq Size 2712
RefSeq ORF 732
Synonyms ARHE; memB; Rho8; RhoE
Locus ID 390
UniProt ID P61587
Cytogenetics 2q23.3
Summary This gene encodes a protein which is a member of the small GTPase protein superfamily. The encoded protein binds only GTP but has no GTPase activity, and appears to act as a negative regulator of cytoskeletal organization leading to loss of adhesion. Multiple alternatively spliced variants, encoding the same protein, have been identified. provided by RefSeq, Dec 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RND3" proteins (3)
SKU Description Size Price
LC417471 Lyophilized RND3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417471 Transient overexpression lysate of Rho family GTPase 3 (RND3) (as WB positive control) 100 ug
$436.00
TP304479 Recombinant protein of human Rho family GTPase 3 (RND3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products