RND3 (NM_005168) Human Tagged ORF Clone

SKU
RC204479
RND3 (Myc-DDK-tagged)-Human Rho family GTPase 3 (RND3)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RND3
Synonyms ARHE; memB; Rho8; RhoE
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204479 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGAGAGAAGAGCCAGCCAGAAATTATCCAGCAAATCTATCATGGATCCTAATCAGAACGTGAAAT
GCAAGATAGTTGTGGTGGGAGACAGTCAGTGTGGAAAAACTGCGCTGCTCCATGTCTTCGCCAAGGACTG
CTTCCCCGAGAATTACGTTCCTACAGTGTTTGAGAATTACACGGCCAGTTTTGAAATCGACACACAAAGA
ATAGAGTTGAGCCTGTGGGACACTTCGGGTTCTCCTTACTATGACAATGTCCGCCCCCTCTCTTACCCTG
ATTCGGATGCTGTGCTGATTTGCTTTGACATCAGTAGACCAGAGACCCTGGACAGTGTCCTCAAAAAGTG
GAAAGGTGAAATCCAGGAATTTTGTCCAAATACCAAAATGCTCTTGGTCGGCTGCAAGTCTGATCTGCGG
ACAGATGTTAGTACATTAGTAGAGCTCTCCAATCACAGGCAGACGCCAGTGTCCTATGACCAGGGGGCAA
ATATGGCCAAACAGATTGGAGCAGCTACTTATATCGAATGCTCAGCTTTACAGTCGGAAAATAGCGTCAG
AGACATTTTTCACGTTGCCACCTTGGCATGTGTAAATAAGACAAATAAAAACGTTAAGCGGAACAAATCA
CAGAGAGCCACAAAGCGGATTTCACACATGCCTAGCAGACCAGAACTCTCGGCAGTTGCTACGGACTTAC
GAAAGGACAAAGCGAAGAGCTGCACTGTGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204479 protein sequence
Red=Cloning site Green=Tags(s)

MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQR
IELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLR
TDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRNKS
QRATKRISHMPSRPELSAVATDLRKDKAKSCTVM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005168
ORF Size 732 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005168.4
RefSeq Size 2712 bp
RefSeq ORF 735 bp
Locus ID 390
UniProt ID P61587
Cytogenetics 2q23.3
Domains RAB, ras, RAS, RHO
MW 27.4 kDa
Summary This gene encodes a protein which is a member of the small GTPase protein superfamily. The encoded protein binds only GTP but has no GTPase activity, and appears to act as a negative regulator of cytoskeletal organization leading to loss of adhesion. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Dec 2011]
Write Your Own Review
You're reviewing:RND3 (NM_005168) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204479L1 Lenti ORF clone of Human Rho family GTPase 3 (RND3), Myc-DDK-tagged 10 ug
$600.00
RC204479L2 Lenti ORF clone of Human Rho family GTPase 3 (RND3), mGFP tagged 10 ug
$600.00
RC204479L3 Lenti ORF clone of Human Rho family GTPase 3 (RND3), Myc-DDK-tagged 10 ug
$600.00
RC204479L4 Lenti ORF clone of Human Rho family GTPase 3 (RND3), mGFP tagged 10 ug
$600.00
RG204479 RND3 (tGFP-tagged) - Human Rho family GTPase 3 (RND3) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116889 RND3 (untagged)-Human Rho family GTPase 3 (RND3) 10 ug
$300.00
SC322482 RND3 (untagged)-Human Rho family GTPase 3 (RND3) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.