BLBP (FABP7) (NM_001446) Human Mass Spec Standard
CAT#: PH304449
FABP7 MS Standard C13 and N15-labeled recombinant protein (NP_001437)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204449 |
Predicted MW | 14.9 kDa |
Protein Sequence |
>RC204449 protein sequence
Red=Cloning site Green=Tags(s) MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEE FDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001437 |
RefSeq Size | 1005 |
RefSeq ORF | 396 |
Synonyms | B-FABP; BLBP; FABPB; MRG |
Locus ID | 2173 |
UniProt ID | O15540 |
Cytogenetics | 6q22.31 |
Summary | The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes. [provided by RefSeq, Jan 2016] |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419933 | FABP7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419933 | Transient overexpression lysate of fatty acid binding protein 7, brain (FABP7) |
USD 436.00 |
|
TP304449 | Recombinant protein of human fatty acid binding protein 7, brain (FABP7), 20 µg |
USD 867.00 |
|
TP720119 | Recombinant protein of human fatty acid binding protein 7, brain (FABP7) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review