BLBP (FABP7) (NM_001446) Human Tagged ORF Clone

SKU
RC204449
FABP7 (Myc-DDK-tagged)-Human fatty acid binding protein 7, brain (FABP7)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BLBP
Synonyms B-FABP; BLBP; FABPB; MRG
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204449 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGAGGCTTTCTGTGCTACCTGGAAGCTGACCAACAGTCAGAACTTTGATGAGTACATGAAGGCTC
TAGGCGTGGGCTTTGCCACTAGGCAGGTGGGAAATGTGACCAAACCAACGGTAATTATCAGTCAAGAAGG
AGACAAAGTGGTCATCAGGACTCTCAGCACATTCAAGAACACGGAGATTAGTTTCCAGCTGGGAGAAGAG
TTTGATGAAACCACTGCAGATGATAGAAACTGTAAGTCTGTTGTTAGCCTGGATGGAGACAAACTTGTTC
ACATACAGAAATGGGATGGCAAAGAAACAAATTTTGTAAGAGAAATTAAGGATGGCAAAATGGTTATGAC
CCTTACTTTTGGTGATGTGGTTGCTGTTCGCCACTATGAGAAGGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204449 protein sequence
Red=Cloning site Green=Tags(s)

MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEE
FDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001446
ORF Size 396 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001446.5
RefSeq Size 1005 bp
RefSeq ORF 399 bp
Locus ID 2173
UniProt ID O15540
Cytogenetics 6q22.31
Domains lipocalin
Protein Pathways PPAR signaling pathway
MW 14.9 kDa
Summary The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes. [provided by RefSeq, Jan 2016]
Write Your Own Review
You're reviewing:BLBP (FABP7) (NM_001446) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204449L1 Lenti ORF clone of Human fatty acid binding protein 7, brain (FABP7), Myc-DDK-tagged 10 ug
$450.00
RC204449L2 Lenti ORF clone of Human fatty acid binding protein 7, brain (FABP7), mGFP tagged 10 ug
$450.00
RC204449L3 Lenti ORF clone of Human fatty acid binding protein 7, brain (FABP7), Myc-DDK-tagged 10 ug
$450.00
RC204449L4 Lenti ORF clone of Human fatty acid binding protein 7, brain (FABP7), mGFP tagged 10 ug
$450.00
RG204449 FABP7 (tGFP-tagged) - Human fatty acid binding protein 7, brain (FABP7) 10 ug
$489.00
SC119224 FABP7 (untagged)-Human fatty acid binding protein 7, brain (FABP7) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.