OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSPBAP1 (NM_024610) Human Mass Spec Standard

Be the first to review this product
SKU
PH304227
HSPBAP1 MS Standard C13 and N15-labeled recombinant protein (NP_078886)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345390 Rabbit Polyclonal Anti-HSPBAP1 Antibody
100 ul
$585.00
LY411200 Transient overexpression lysate of HSPB (heat shock 27kDa) associated protein 1 (HSPBAP1) (as WB positive control) 100 ug
$436.00

Other products for "HSPBAP1 or NM_024610"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204227
Predicted MW 55.2 kDa
Protein Sequence
Protein Sequence
>RC204227 protein sequence
Red=Cloning site Green=Tags(s)

MAAGSEATTPVIVAAGAGGEEGEHVKPFKPEKAKEIIMSLQQPAIFCNMVFDWPARHWNAKYLSQVLHGK
QIRFRMGMKSMSTVPQFETTCNYVEATLEEFLTWNCDQSSISGPFRDYDHSKFWAYADYKYFVSLFEDKT
DLFQDVKWSDFGFPGRNGQESTLWIGSLGAHTPCHLDSYGCNLVFQVQGRKRWHLFPPEDTPFLYPTRIP
YEESSVFSKINVVNPDLKRFPQFRKAQRHAVTLSPGQVLFVPRHWWHYVESIDPVTVSINSWIELEEDHL
ARVEEAITRMLVCALKTAENPQNTRAWLNPTEVEETSHAVNCCYLNAAVSAFFDRCRTSEVVEIQALRTD
GEHMKKEELNVCNHMEVGQTGSQNLTTGTDKPEAASPFGPDLVPVAQRSEEPPSERGGIFGSDGKDFVDK
DGEHFGKLHCAKRQQIMSNSENAIEEQIASNTTTTPQTFISTDDLLDCLVNPQVTRIVAQLLIQGRSL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078886
RefSeq Size 1972
RefSeq ORF 1464
Synonyms PASS1
Locus ID 79663
UniProt ID Q96EW2
Cytogenetics 3q21.1
Summary This gene encodes a protein that binds to one of the small heat shock proteins, specifically hsp27. Hsp27 is involved with cell growth and differentiation. This encoded protein was found to be abnormally expressed in patients with intractable epilepsy, although how brain function is affected remains unknown. provided by RefSeq, Sep 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HSPBAP1" proteins (3)
SKU Description Size Price
LC411200 Lyophilized HSPBAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411200 Transient overexpression lysate of HSPB (heat shock 27kDa) associated protein 1 (HSPBAP1) (as WB positive control) 100 ug
$436.00
TP304227 Recombinant protein of human HSPB (heat shock 27kDa) associated protein 1 (HSPBAP1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products