OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EB3 (MAPRE3) (NM_012326) Human Mass Spec Standard

Be the first to review this product
SKU
PH304135
MAPRE3 MS Standard C13 and N15-labeled recombinant protein (NP_036458)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349912 Rabbit Polyclonal Anti-MAPRE3 Antibody
100 ul
$205.00
LY415770 Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 3 (MAPRE3) (as WB positive control) 100 ug
$436.00

Other products for "EB3 or NM_012326"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204135
Predicted MW 32 kDa
Protein Sequence
Protein Sequence
>RC204135 protein sequence
Red=Cloning site Green=Tags(s)

MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHE
YIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPN
PGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLV
DLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDE
Y

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036458
RefSeq Size 1880
RefSeq ORF 843
Synonyms EB3; EBF3; EBF3-S; RP3
Locus ID 22924
UniProt ID Q9UPY8
Cytogenetics 2p23.3
Summary The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EB3" proteins (3)
SKU Description Size Price
LC415770 Lyophilized MAPRE3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415770 Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 3 (MAPRE3) (as WB positive control) 100 ug
$436.00
TP304135 Recombinant protein of human microtubule-associated protein, RP/EB family, member 3 (MAPRE3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products