OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EB3 (MAPRE3) (NM_012326) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC204135
MAPRE3 (Myc-DDK-tagged)-Human microtubule-associated protein, RP/EB family, member 3 (MAPRE3)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA349912 Rabbit Polyclonal Anti-MAPRE3 Antibody
100 ul
$205.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "EB3 or NM_012326"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EB3
Synonyms EB3; EBF3; EBF3-S; RP3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204135 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGTCAATGTGTACTCCACATCTGTGACCAGTGAAAATCTGAGTCGCCATGATATGCTTGCATGGG
TCAACGACTCCCTGCACCTCAACTATACCAAGATAGAACAGCTTTGTTCAGGGGCAGCCTACTGCCAGTT
CATGGACATGCTCTTCCCCGGCTGTGTGCACTTGAGGAAAGTGAAGTTCCAGGCCAAACTAGAGCATGAA
TACATCCACAACTTCAAGGTGCTGCAAGCAGCTTTCAAGAAGATGGGTGTTGACAAAATCATTCCTGTAG
AGAAATTAGTGAAAGGAAAATTCCAAGATAATTTTGAGTTTATTCAGTGGTTTAAGAAATTCTTTGACGC
AAACTATGATGGAAAGGATTACAACCCTCTGCTGGCGCGGCAGGGCCAGGACGTAGCGCCACCTCCTAAC
CCAGGTGATCAGATCTTCAACAAATCCAAGAAACTCATTGGCACAGCAGTTCCACAGAGGACGTCCCCCA
CAGGCCCAAAAAACATGCAGACCTCTGGCCGGCTGAGCAATGTGGCCCCCCCCTGCATTCTCCGGAAGAA
TCCTCCATCAGCCCGAAATGGCGGCCATGAGACTGATGCCCAAATTCTTGAACTCAACCAACAGCTGGTG
GACTTGAAGCTGACAGTGGATGGGCTGGAGAAGGAACGTGACTTCTACTTCAGCAAACTTCGTGACATCG
AGCTCATCTGCCAGGAGCATGAAAGTGAAAACAGCCCTGTTATCTCAGGCATCATTGGCATCCTCTATGC
CACAGAGGAAGGATTCGCACCCCCTGAGGACGATGAGATTGAAGAGCATCAACAAGAAGACCAGGACGAG
TAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204135 protein sequence
Red=Cloning site Green=Tags(s)

MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHE
YIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPN
PGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLV
DLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDE
Y

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_012326
ORF Size 843 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012326.2, NP_036458.2
RefSeq Size 1880 bp
RefSeq ORF 846 bp
Locus ID 22924
UniProt ID Q9UPY8
Cytogenetics 2p23.3
Domains CH, EB1
MW 32 kDa
Summary The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_012326" in other vectors (4)
SKU Description Size Price
RC204135L3 Lenti ORF clone of Human microtubule-associated protein, RP/EB family, member 3 (MAPRE3), Myc-DDK-tagged 10 ug
$600.00
RC204135L4 Lenti ORF clone of Human microtubule-associated protein, RP/EB family, member 3 (MAPRE3), mGFP tagged 10 ug
$600.00
RG204135 MAPRE3 (tGFP-tagged) - Human microtubule-associated protein, RP/EB family, member 3 (MAPRE3) 10 ug
$489.00 $500.00
SC321616 MAPRE3 (untagged)-Human microtubule-associated protein, RP/EB family, member 3 (MAPRE3) 10 ug
$300.00

Plasmid Map for RC204135

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC204135
Circular map for RC204135

file-alt Citations

The NAP motif of activity-dependent neuroprotective protein (ADNP) regulates dendritic spines through microtubule end binding proteins
Oz, Kapitansky, Ivashco-Pachima et al
Mol. Psychiatry (2014)
Cited by 157
AI Summary: OriGene’s Human EB3 (pEX-N-His Vector, CW300309) recombinant protein was used in this study to investigate the interaction between the NAP motif of ADNP and microtubule end-binding proteins, helping to elucidate the molecular mechanisms underlying NAP’s regulation of dendritic spines and neuroprotection.
Snippet: Canada). Recombinant EBs. Human EB3 (pEX-N-His Vector;OriGene, Rockville, MD) was subcloned into pEX-N-His vector (PrecisionShuttle bacterial expression vector with N-terminal His tag CW300309, OriGene). Competent ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products