OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD99 (NM_002414) Human Mass Spec Standard

Be the first to review this product
SKU
PH304056
CD99 MS Standard C13 and N15-labeled recombinant protein (NP_002405)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA800824 CD99 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5) 100 ul
$447.00
LY400863 Transient overexpression lysate of CD99 molecule (CD99), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CD99 or NM_002414"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204056
Predicted MW 18.8 kDa
Protein Sequence
Protein Sequence
>RC204056 protein sequence
Red=Cloning site Green=Tags(s)

MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPP
NPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAG
AISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002405
RefSeq Size 1255
RefSeq ORF 555
Synonyms HBA71; MIC2; MIC2X; MIC2Y; MSK5X
Locus ID 4267
UniProt ID P14209
Cytogenetics X;Y
Summary The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus. provided by RefSeq, Mar 2016
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD99" proteins (6)
SKU Description Size Price
LC400863 Lyophilized CD99 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426583 Lyophilized CD99 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400863 Transient overexpression lysate of CD99 molecule (CD99), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426583 Transient overexpression lysate of CD99 molecule (CD99), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP304056 Purified recombinant protein of Homo sapiens CD99 molecule (CD99), transcript variant 1, 20 µg 20 ug
$867.00
TP720374 Recombinant protein of human CD99 molecule (CD99), transcript variant 2 10 ug
$210.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products