OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NEU4 (NM_080741) Human Mass Spec Standard

Be the first to review this product
SKU
PH303948
NEU4 MS Standard C13 and N15-labeled recombinant protein (NP_542779)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA340248 Rabbit Polyclonal Anti-NEU4 Antibody
100 ul
$585.00
LY409058 Transient overexpression lysate of sialidase 4 (NEU4), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "NEU4 or NM_080741"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203948
Predicted MW 52.9 kDa
Protein Sequence
Protein Sequence
>RC203948 protein sequence
Red=Cloning site Green=Tags(s)

MMSSAAFPRWLSMGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRR
GTLAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVA
SRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYRVDRRECFGKICRTSPHSF
AFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVAS
LPETAWGCQGSIVGFPAPAPNRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQ
PRGDGPRQPGPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTE
PWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPR
GCCWPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542779
RefSeq Size 2373
RefSeq ORF 1488
Locus ID 129807
UniProt ID Q8WWR8
Cytogenetics 2q37.3
Summary The protein encoded by this gene belongs to a family of glycohydrolytic enzymes, which remove terminal sialic acid residues from various sialo derivatives, such as glycoproteins, glycolipids, oligosaccharides, and gangliosides. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. provided by RefSeq, Nov 2009
Protein Pathways Other glycan degradation, Sphingolipid metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NEU4" proteins (3)
SKU Description Size Price
LC409058 Lyophilized NEU4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409058 Transient overexpression lysate of sialidase 4 (NEU4), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303948 Recombinant protein of human sialidase 4 (NEU4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products