NCE2 (UBE2F) (NM_080678) Human Mass Spec Standard

CAT#: PH303942

UBE2F MS Standard C13 and N15-labeled recombinant protein (NP_542409)

Product Images

Coomassie blue staining of purified UBE2F protein (Cat# TP303942). The protein was produced from HEK293T cells transfected with UBE2F cDNA clone (Cat# RC203942) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203942
• Predicted MW: 20.9 kDa
• Protein Sequence:
  Sequence Link

  >RC203942 representing NM_080678
  Red=Cloning site Green=Tags(s)
  
  MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVT
  PDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVV
  WGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_542409
• RefSeq Size: 1366
• RefSeq ORF: 555
• Synonyms: NCE2
• Locus ID: 140739
• UniProt ID: Q969M7
• Cytogenetics: 2q37.3
• Summary: Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Ubiquitin mediated proteolysis