NCE2 (UBE2F) (NM_080678) Human Mass Spec Standard
CAT#: PH303942
UBE2F MS Standard C13 and N15-labeled recombinant protein (NP_542409)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203942 |
Predicted MW | 20.9 kDa |
Protein Sequence |
>RC203942 representing NM_080678
Red=Cloning site Green=Tags(s) MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVT PDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVV WGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_542409 |
RefSeq Size | 1366 |
RefSeq ORF | 555 |
Synonyms | NCE2 |
Locus ID | 140739 |
UniProt ID | Q969M7 |
Cytogenetics | 2q37.3 |
Summary | Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409102 | UBE2F HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409102 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2F (putative) (UBE2F) |
USD 436.00 |
|
TP303942 | Recombinant protein of human ubiquitin-conjugating enzyme E2F (putative) (UBE2F), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review