OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSMG3 (NM_032302) Human Mass Spec Standard

Be the first to review this product
SKU
PH303835
PSMG3 MS Standard C13 and N15-labeled recombinant protein (NP_115678)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA357697 PSMG3 Antibody - C-terminal region
100 ul
$585.00
LY410244 Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PSMG3 or NM_032302"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203835
Predicted MW 13.1 kDa
Protein Sequence
Protein Sequence
>RC203835 protein sequence
Red=Cloning site Green=Tags(s)

MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQ
DEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115678
RefSeq Size 1395
RefSeq ORF 366
Synonyms C7orf48; PAC3
Locus ID 84262
UniProt ID Q9BT73
Cytogenetics 7p22.3
Summary Chaperone protein which promotes assembly of the 20S proteasome. May cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PSMG3" proteins (6)
SKU Description Size Price
LC410244 Lyophilized PSMG3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427395 Lyophilized PSMG3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410244 Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427395 Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303835 Recombinant protein of human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1, 20 µg 20 ug
$867.00
TP760843 Purified recombinant protein of Human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products