PSMG3 (NM_032302) Human Tagged ORF Clone

SKU
RC203835
PSMG3 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PSMG3
Synonyms C7orf48; PAC3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203835 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGACACGCCGTTGGTGATATCGAAGCAGAAGACGGAGGTGGTGTGCGGGGTCCCCACCCAGGTGG
TGTGTACGGCCTTCAGCAGTCACATCCTGGTGGTGGTGACCCAGTTTGGGAAGATGGGCACCCTGGTCTC
CCTGGAGCCCAGCAGCGTGGCCAGTGACGTCAGCAAGCCTGTGCTCACCACAAAAGTCCTTCTGGGGCAG
GATGAGCCTCTCATCCATGTCTTTGCAAAGAACCTGGTAGCGTTTGTGTCTCAAGAAGCTGGAAACAGAG
CAGTCCTCCTCGCCGTGGCCGTGAAGGACAAAAGCATGGAGGGGCTGAAGGCGCTGAGGGAGGTGATCCG
GGTGTGCCAGGTGTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203835 protein sequence
Red=Cloning site Green=Tags(s)

MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQ
DEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032302
ORF Size 366 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032302.4
RefSeq Size 1395 bp
RefSeq ORF 369 bp
Locus ID 84262
UniProt ID Q9BT73
Cytogenetics 7p22.3
MW 13.1 kDa
Summary Chaperone protein which promotes assembly of the 20S proteasome. May cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PSMG3 (NM_032302) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203835L1 Lenti ORF clone of Human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC203835L2 Lenti ORF clone of Human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1, mGFP tagged 10 ug
$450.00
RC203835L3 Lenti ORF clone of Human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC203835L4 Lenti ORF clone of Human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1, mGFP tagged 10 ug
$450.00
RG203835 PSMG3 (tGFP-tagged) - Human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1 10 ug
$489.00
SC105535 PSMG3 (untagged)-Human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.