OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PCP4 (NM_006198) Human Mass Spec Standard

Be the first to review this product
SKU
PH303796
PCP4 MS Standard C13 and N15-labeled recombinant protein (NP_006189)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY416805 Transient overexpression lysate of Purkinje cell protein 4 (PCP4) (as WB positive control) 100 ug
$436.00

Other products for "PCP4 or NM_006198"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203796
Predicted MW 6.8 kDa
Protein Sequence
Protein Sequence
>RC203796 protein sequence
Red=Cloning site Green=Tags(s)

MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006189
RefSeq Size 566
RefSeq ORF 186
Synonyms PEP-19
Locus ID 5121
UniProt ID P48539
Cytogenetics 21q22.2
Summary Functions as a modulator of calcium-binding by calmodulin. Thereby, regulates calmodulin activity and the different processes it controls (PubMed:19106096, PubMed:23204517, PubMed:27876793). For instance, may play a role in neuronal differentiation through activation of calmodulin-dependent kinase signaling pathways (PubMed:21491429).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PCP4" proteins (3)
SKU Description Size Price
LC416805 Lyophilized PCP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416805 Transient overexpression lysate of Purkinje cell protein 4 (PCP4) (as WB positive control) 100 ug
$436.00
TP303796 Recombinant protein of human Purkinje cell protein 4 (PCP4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products