OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GRAMD2B (NM_023927) Human Mass Spec Standard

Be the first to review this product
SKU
PH303681
GRAMD3 MS Standard C13 and N15-labeled recombinant protein (NP_076416)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA311196 Goat Anti-GRAMD3 Antibody
100 ug
$565.00
LY431357 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 5 (as WB positive control) 100 ug
$436.00

Other products for "GRAMD2B or NM_023927"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203681
Predicted MW 47.9 kDa
Protein Sequence
Protein Sequence
>RC203681 protein sequence
Red=Cloning site Green=Tags(s)

MTELQQDVEDTKPAKVLGKRESKLGSAHSEAENGVEEKKKACRSPTAQSPTPSVEADSPDQKKIISLWSK
SSFDGASLASDKNDCKTESKNDPKTERKKSSSSSQYKANMHFHKLFLSVPTEEPLKQSFTCALQKEILYQ
GKLFVSENWICFHSKVFGKDTKISIPAFSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKLL
KSVCGHLENTSVGNSPNPSSAENSFRADRPSSLPLDFNDEFSDLDGVVQQRRQDMEGYSSSGSQTPESEN
SRDFHATESQTVLNVSKGEAKPTRADAHVNRVPEGKAKSLPVQGLSETVGILHKVKSQKCPMLHHILIFY
AIVVCALIISTFYMRYRINTLEEQLGLLTSIVDTHNTEQAAPSGLRSQVQFNVEVLCQELTANIVKLEKI
QNNLQKLLENGD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076416
RefSeq Size 2934
RefSeq ORF 1296
Synonyms GRAMD3; NS3TP2
Locus ID 65983
UniProt ID Q96HH9
Cytogenetics 5q23.2
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GRAMD2B" proteins (9)
SKU Description Size Price
LC411432 Lyophilized GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431286 Lyophilized GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431357 Lyophilized GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431387 Lyophilized GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411432 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431286 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY431357 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY431387 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303681 Recombinant protein of human GRAM domain containing 3 (GRAMD3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products