OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GRAMD2B (NM_023927) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303681
Recombinant protein of human GRAM domain containing 3 (GRAMD3), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA311196 Goat Anti-GRAMD3 Antibody
100 ug
$565.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "GRAMD2B or NM_023927"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203681 protein sequence
Red=Cloning site Green=Tags(s)

MTELQQDVEDTKPAKVLGKRESKLGSAHSEAENGVEEKKKACRSPTAQSPTPSVEADSPDQKKIISLWSK
SSFDGASLASDKNDCKTESKNDPKTERKKSSSSSQYKANMHFHKLFLSVPTEEPLKQSFTCALQKEILYQ
GKLFVSENWICFHSKVFGKDTKISIPAFSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKLL
KSVCGHLENTSVGNSPNPSSAENSFRADRPSSLPLDFNDEFSDLDGVVQQRRQDMEGYSSSGSQTPESEN
SRDFHATESQTVLNVSKGEAKPTRADAHVNRVPEGKAKSLPVQGLSETVGILHKVKSQKCPMLHHILIFY
AIVVCALIISTFYMRYRINTLEEQLGLLTSIVDTHNTEQAAPSGLRSQVQFNVEVLCQELTANIVKLEKI
QNNLQKLLENGD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 47.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_076416
Locus ID 65983
UniProt ID Q96HH9
Cytogenetics 5q23.2
RefSeq Size 2934
RefSeq ORF 1296
Synonyms GRAMD3; NS3TP2
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GRAMD2B" proteins (9)
SKU Description Size Price
PH303681 GRAMD3 MS Standard C13 and N15-labeled recombinant protein (NP_076416) 10 ug
$3,360.00
LC411432 Lyophilized GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431286 Lyophilized GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431357 Lyophilized GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431387 Lyophilized GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411432 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431286 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY431357 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY431387 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products