GRAMD2B (NM_023927) Human Recombinant Protein

SKU
TP303681
Recombinant protein of human GRAM domain containing 3 (GRAMD3), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203681 protein sequence
Red=Cloning site Green=Tags(s)

MTELQQDVEDTKPAKVLGKRESKLGSAHSEAENGVEEKKKACRSPTAQSPTPSVEADSPDQKKIISLWSK
SSFDGASLASDKNDCKTESKNDPKTERKKSSSSSQYKANMHFHKLFLSVPTEEPLKQSFTCALQKEILYQ
GKLFVSENWICFHSKVFGKDTKISIPAFSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKLL
KSVCGHLENTSVGNSPNPSSAENSFRADRPSSLPLDFNDEFSDLDGVVQQRRQDMEGYSSSGSQTPESEN
SRDFHATESQTVLNVSKGEAKPTRADAHVNRVPEGKAKSLPVQGLSETVGILHKVKSQKCPMLHHILIFY
AIVVCALIISTFYMRYRINTLEEQLGLLTSIVDTHNTEQAAPSGLRSQVQFNVEVLCQELTANIVKLEKI
QNNLQKLLENGD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 47.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_076416
Locus ID 65983
UniProt ID Q96HH9
Cytogenetics 5q23.2
RefSeq Size 2934
RefSeq ORF 1296
Synonyms GRAMD3; NS3TP2
Protein Families Transmembrane
Write Your Own Review
You're reviewing:GRAMD2B (NM_023927) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303681 GRAMD3 MS Standard C13 and N15-labeled recombinant protein (NP_076416) 10 ug
$3,255.00
LC411432 GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431286 GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431357 GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431387 GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411432 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 2 100 ug
$436.00
LY431286 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 3 100 ug
$436.00
LY431357 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 5 100 ug
$436.00
LY431387 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.