GRAMD2B (NM_023927) Human Mass Spec Standard

SKU
PH303681
GRAMD3 MS Standard C13 and N15-labeled recombinant protein (NP_076416)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203681]
Predicted MW 47.9 kDa
Protein Sequence
Protein Sequence
>RC203681 protein sequence
Red=Cloning site Green=Tags(s)

MTELQQDVEDTKPAKVLGKRESKLGSAHSEAENGVEEKKKACRSPTAQSPTPSVEADSPDQKKIISLWSK
SSFDGASLASDKNDCKTESKNDPKTERKKSSSSSQYKANMHFHKLFLSVPTEEPLKQSFTCALQKEILYQ
GKLFVSENWICFHSKVFGKDTKISIPAFSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKLL
KSVCGHLENTSVGNSPNPSSAENSFRADRPSSLPLDFNDEFSDLDGVVQQRRQDMEGYSSSGSQTPESEN
SRDFHATESQTVLNVSKGEAKPTRADAHVNRVPEGKAKSLPVQGLSETVGILHKVKSQKCPMLHHILIFY
AIVVCALIISTFYMRYRINTLEEQLGLLTSIVDTHNTEQAAPSGLRSQVQFNVEVLCQELTANIVKLEKI
QNNLQKLLENGD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076416
RefSeq Size 2934
RefSeq ORF 1296
Synonyms GRAMD3; NS3TP2
Locus ID 65983
UniProt ID Q96HH9
Cytogenetics 5q23.2
Protein Families Transmembrane
Write Your Own Review
You're reviewing:GRAMD2B (NM_023927) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411432 GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431286 GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431357 GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431387 GRAMD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411432 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 2 100 ug
$436.00
LY431286 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 3 100 ug
$436.00
LY431357 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 5 100 ug
$436.00
LY431387 Transient overexpression lysate of GRAM domain containing 3 (GRAMD3), transcript variant 1 100 ug
$436.00
TP303681 Recombinant protein of human GRAM domain containing 3 (GRAMD3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.