OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPSB1 (NM_025106) Human Mass Spec Standard

Be the first to review this product
SKU
PH303673
SPSB1 MS Standard C13 and N15-labeled recombinant protein (NP_079382)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331360 Rabbit Polyclonal Anti-SPSB1 Antibody
100 ul
$585.00
LY410888 Transient overexpression lysate of splA/ryanodine receptor domain and SOCS box containing 1 (SPSB1) (as WB positive control) 100 ug
$436.00

Other products for "SPSB1 or NM_025106"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203673
Predicted MW 30.9 kDa
Protein Sequence
Protein Sequence
>RC203673 protein sequence
Red=Cloning site Green=Tags(s)

MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKED
DKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESW
GWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLY
PVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079382
RefSeq Size 3130
RefSeq ORF 819
Synonyms SSB-1; SSB1
Locus ID 80176
UniProt ID Q96BD6
Cytogenetics 1p36.22
Summary Substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:15601820, PubMed:21199876). Negatively regulates nitric oxide (NO) production and limits cellular toxicity in activated macrophages by mediating the ubiquitination and proteasomal degradation of NOS2 (PubMed:21199876). Acts as a bridge which links NOS2 with the ECS E3 ubiquitin ligase complex components ELOC and CUL5 (PubMed:21199876).UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPSB1" proteins (3)
SKU Description Size Price
LC410888 Lyophilized SPSB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410888 Transient overexpression lysate of splA/ryanodine receptor domain and SOCS box containing 1 (SPSB1) (as WB positive control) 100 ug
$436.00
TP303673 Recombinant protein of human splA/ryanodine receptor domain and SOCS box containing 1 (SPSB1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products