SPSB1 (NM_025106) Human Tagged ORF Clone

SKU
RC203673
SPSB1 (Myc-DDK-tagged)-Human splA/ryanodine receptor domain and SOCS box containing 1 (SPSB1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SPSB1
Synonyms SSB-1; SSB1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203673 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTCAGAAGGTCACTGGAGGGATCAAGACTGTGGACATGAGGGACCCCACGTACAGGCCCCTGAAGC
AGGAGCTCCAGGGTCTGGATTACTGCAAGCCCACCCGGCTGGATCTGCTACTGGACATGCCCCCTGTGTC
CTATGATGTCCAGCTGCTGCATTCATGGAACAACAACGACCGATCGCTCAATGTCTTTGTGAAGGAGGAC
GACAAGCTCATCTTTCACCGGCATCCGGTGGCCCAGAGCACGGACGCTATCAGGGGCAAAGTCGGGTATA
CCCGTGGGCTGCACGTGTGGCAGATCACGTGGGCCATGAGACAGCGGGGCACACACGCCGTGGTGGGGGT
GGCGACGGCAGACGCCCCCCTGCACTCTGTCGGGTACACAACCCTCGTGGGGAATAACCACGAGTCCTGG
GGCTGGGACTTGGGGCGCAACCGGCTCTACCACGATGGCAAGAACCAGCCAAGCAAAACATACCCAGCCT
TTCTGGAACCAGATGAGACATTCATTGTCCCTGACTCCTTCCTGGTAGCCCTGGACATGGACGACGGGAC
TCTGAGCTTCATTGTGGATGGACAGTACATGGGAGTGGCTTTTCGGGGACTCAAGGGCAAAAAACTGTAT
CCTGTAGTGAGTGCCGTCTGGGGCCACTGTGAGATCCGAATGCGCTACTTGAACGGACTCGATCCCGAGC
CGCTGCCGCTCATGGATTTGTGCCGTCGCTCGGTGCGCCTGGCCCTGGGGAGGGAGCGCCTGGGGGAGAT
CCACACGCTGCCGCTGCCGGCTTCCCTCAAGGCCTACCTCCTCTACCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203673 protein sequence
Red=Cloning site Green=Tags(s)

MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKED
DKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESW
GWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLY
PVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_025106
ORF Size 819 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025106.4
RefSeq Size 3130 bp
RefSeq ORF 822 bp
Locus ID 80176
UniProt ID Q96BD6
Cytogenetics 1p36.22
Domains SPRY
Protein Families Druggable Genome
MW 30.9 kDa
Summary Substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:15601820, PubMed:21199876). Negatively regulates nitric oxide (NO) production and limits cellular toxicity in activated macrophages by mediating the ubiquitination and proteasomal degradation of NOS2 (PubMed:21199876). Acts as a bridge which links NOS2 with the ECS E3 ubiquitin ligase complex components ELOC and CUL5 (PubMed:21199876).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SPSB1 (NM_025106) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203673L3 Lenti ORF clone of Human splA/ryanodine receptor domain and SOCS box containing 1 (SPSB1), Myc-DDK-tagged 10 ug
$600.00
RC203673L4 Lenti ORF clone of Human splA/ryanodine receptor domain and SOCS box containing 1 (SPSB1), mGFP tagged 10 ug
$600.00
RG203673 SPSB1 (tGFP-tagged) - Human splA/ryanodine receptor domain and SOCS box containing 1 (SPSB1) 10 ug
$500.00
SC110780 SPSB1 (untagged)-Human splA/ryanodine receptor domain and SOCS box containing 1 (SPSB1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.