OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC34 (NM_080654) Human Mass Spec Standard

Be the first to review this product
SKU
PH303345
CCDC34 MS Standard C13 and N15-labeled recombinant protein (NP_542385)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333559 Rabbit Polyclonal Anti-CCDC34 Antibody
100 ul
$585.00
LY409124 Transient overexpression lysate of coiled-coil domain containing 34 (CCDC34), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "CCDC34 or NM_080654"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203345
Predicted MW 26.1 kDa
Protein Sequence
Protein Sequence
>RC203345 representing NM_080654
Red=Cloning site Green=Tags(s)

MWAAGRWGPTFPSSYAGFSADCRPRSRPSSDSCSVPMTGARGQGLEVVRSPSPPLPLSCSNSTRSLLSPL
GHQSFQFDEDDGDGEDEEDVDDEEDVDEDAHDSEAKVASLRGMELQGCASTQVESENNQEEQKQVRLPES
RLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEKHKEWVQKKNEQVRRGKWIH
TLTSLLQNISSYYTSLPRF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542385
RefSeq Size 2120
RefSeq ORF 687
Synonyms L15; NY-REN-41; RAMA3
Locus ID 91057
UniProt ID Q96HJ3
Cytogenetics 11p14.1
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC34" proteins (5)
SKU Description Size Price
LC409124 Lyophilized CCDC34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410721 Lyophilized CCDC34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409124 Transient overexpression lysate of coiled-coil domain containing 34 (CCDC34), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY410721 Transient overexpression lysate of coiled-coil domain containing 34 (CCDC34), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303345 Recombinant protein of human coiled-coil domain containing 34 (CCDC34), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products