CCDC34 (NM_080654) Human Recombinant Protein

SKU
TP303345
Recombinant protein of human coiled-coil domain containing 34 (CCDC34), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203345 representing NM_080654
Red=Cloning site Green=Tags(s)

MWAAGRWGPTFPSSYAGFSADCRPRSRPSSDSCSVPMTGARGQGLEVVRSPSPPLPLSCSNSTRSLLSPL
GHQSFQFDEDDGDGEDEEDVDDEEDVDEDAHDSEAKVASLRGMELQGCASTQVESENNQEEQKQVRLPES
RLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEKHKEWVQKKNEQVRRGKWIH
TLTSLLQNISSYYTSLPRF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_542385
Locus ID 91057
UniProt ID Q96HJ3
Cytogenetics 11p14.1
RefSeq Size 2120
RefSeq ORF 687
Synonyms L15; NY-REN-41; RAMA3
Write Your Own Review
You're reviewing:CCDC34 (NM_080654) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303345 CCDC34 MS Standard C13 and N15-labeled recombinant protein (NP_542385) 10 ug
$3,255.00
LC409124 CCDC34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410721 CCDC34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409124 Transient overexpression lysate of coiled-coil domain containing 34 (CCDC34), transcript variant 2 100 ug
$436.00
LY410721 Transient overexpression lysate of coiled-coil domain containing 34 (CCDC34), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.