OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RNF166 (NM_178841) Human Mass Spec Standard

Be the first to review this product
SKU
PH303224
RNF166 MS Standard C13 and N15-labeled recombinant protein (NP_849163)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA325048 RNF166 Antibody (Center)
400 ul
$645.00
LY405857 Transient overexpression lysate of ring finger protein 166 (RNF166), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "RNF166 or NM_178841"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203224
Predicted MW 26.1 kDa
Protein Sequence
Protein Sequence
>RC203224 protein sequence
Red=Cloning site Green=Tags(s)

MAMFRSLVASAQQRQPPAGPAGGDSGLEAQYTCPICLEVYHRPVAIGSCGHTFCGECLQPCLQVPSPLCP
LCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRVHISSCLKVQEQMANCPKFVPVVPTSQPI
PSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMPWGDPSYKSANFLQHLLHRHKF
SYDTFVDYSIDEEAAFQAALALSLSEN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_849163
RefSeq Size 1888
RefSeq ORF 711
Locus ID 115992
UniProt ID Q96A37
Cytogenetics 16q24.2-q24.3
Summary E3 ubiquitin-protein ligase that promotes the ubiquitination of different substrates (PubMed:27880896). In turn, participates in different biological processes including interferon production or autophagy (PubMed:26456228, PubMed:27880896). Plays a role in the activation of RNA virus-induced interferon-beta production by promoting the ubiquitination of TRAF3 and TRAF6 (PubMed:26456228). Plays also a role in the early recruitment of autophagy adapters to bacteria (PubMed:27880896). Mediates 'Lys-29' and 'Lys-33'-linked ubiquitination of SQSTM1 leading to xenophagic targeting of bacteria and inhibition of their replication (PubMed:27880896).UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RNF166" proteins (3)
SKU Description Size Price
LC405857 Lyophilized RNF166 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405857 Transient overexpression lysate of ring finger protein 166 (RNF166), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303224 Recombinant protein of human ring finger protein 166 (RNF166), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products