OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RNF34 (NM_025126) Human Mass Spec Standard

Be the first to review this product
SKU
PH303191
RNF34 MS Standard C13 and N15-labeled recombinant protein (NP_079402)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345656 Rabbit Polyclonal Anti-RNF34 Antibody
100 ul
$585.00
LY403050 Transient overexpression lysate of ring finger protein 34 (RNF34), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "RNF34 or NM_025126"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203191
Predicted MW 41.6 kDa
Protein Sequence
Protein Sequence
>RC203191 protein sequence
Red=Cloning site Green=Tags(s)

MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVCKACGLSFS
VFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREK
EDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPA
QVQSEITSANTEDDDDDDDEDDDDEEENAEDRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNF
VNYSGCCEKWELVEKVNRLYKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCG
KRMSECPICRQYVVRAVHVFKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079402
RefSeq Size 2055
RefSeq ORF 1116
Synonyms CARP-1; CARP1; hRFI; RFI; RIF; RIFF
Locus ID 80196
UniProt ID Q969K3
Cytogenetics 12q24.31
Summary The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3 during the induction of apoptosis. This protein also targets p53 and phospho-p53 for degradation. Alternatively splicing results in multiple transcript variants encoding distinct isoforms. provided by RefSeq, Feb 2012
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RNF34" proteins (5)
SKU Description Size Price
LC403050 Lyophilized RNF34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403664 Lyophilized RNF34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403050 Transient overexpression lysate of ring finger protein 34 (RNF34), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY403664 Transient overexpression lysate of ring finger protein 34 (RNF34), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303191 Recombinant protein of human ring finger protein 34 (RNF34), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products