OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RNF34 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA345656
Rabbit Polyclonal Anti-RNF34 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY403050 Transient overexpression lysate of ring finger protein 34 (RNF34), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303191 Recombinant protein of human ring finger protein 34 (RNF34), transcript variant 2, 20 µg
20 ug
$867.00

View other "RNF34 or NM_025126" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RNF34 antibody: synthetic peptide directed towards the middle region of human RNF34. Synthetic peptide located within the following region: LVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 42 kDa
Gene Name ring finger protein 34
Database Link
Background RNF34 contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3 during the induction of apoptosis.The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3 during the induction of apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Synonyms CARP-1; CARP1; hRFI; RFI; RIF; RIFF
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 87%; Pig: 80%; Rabbit: 80%; Guinea pig: 80%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

RNF34 ablation promotes cerebrovascular remodeling and hypertension by increasing NADPH-derived ROS generation
Fang, Cheng, Deng et al
Neurobiol Dis (2021) 156, 105396 DOI: 10.1016/j.nbd.2021.105396
Cited by 16
AI Summary: In this study, the RNF34 antibody from OriGene Technologies was used to detect RNF34 protein expression, helping to elucidate its role in cerebrovascular remodeling and hypertension.
Snippet: phox , p67 phox , p22 phox (1:1000;Santa Cruz Biotechnology), NOX2 (1:500, Abcam, Cambridge, MA), p-p47 phox , p-p67 phox (1:300), Myc-tag, GFP-tag, HA-tag, β-actin (1:1000) (Cell Signaling Technology, Billerica, MA), and RNF34 (1:500;OriGene Technologies;and RNF34 (1:500;OriGene Technologies, Beijing, China)
WB IP
RNF34 overexpression exacerbates neurological deficits and brain injury in a mouse model of intracerebral hemorrhage by potentiating mitochondrial dysfunction-mediated oxidative stress
Qu, Wang, Chen et al
Sci Rep (2019) 9 (1), 16296 DOI: 10.1038/s41598-019-52494-x
AI Summary: OriGene’s RNF34 antibody was used in this study to detect RNF34 protein expression, enabling the researchers to investigate its role in exacerbating neurological deficits and brain injury following intracerebral hemorrhage in mice.
Snippet: membranes (Millipore, Billerica, MA) at 200 mA for 90 min. After blocking by 5% non-fat milk, the membranes were incubated by the following primary antibodies at 4 °C overnight: RNF34 (1:500) (OriGene Technologies, Beijing, China), PGC-1α (1:800) (Abcam, Cambridge, MA), uncoupling protein 2 (UCP2), manganese-dependent superoxide dismutase (MnSOD) and GAPDH (1:1000) (Santa Cruz Biotechnolog
FigureFigureFigure
WB
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products