OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GAP43 (NM_002045) Human Mass Spec Standard

Be the first to review this product
SKU
PH303175
GAP43 MS Standard C13 and N15-labeled recombinant protein (NP_002036)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA367658 GAP43 rabbit polyclonal antibody
100 ul
$310.00
LY400750 Transient overexpression lysate of growth associated protein 43 (GAP43), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "GAP43 or NM_002045"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203175
Predicted MW 24.8 kDa
Protein Sequence
Protein Sequence
>RC203175 protein sequence
Red=Cloning site Green=Tags(s)

MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKD
EAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAET
ESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIE
AVDETKPKESARQDEGKEEEPEADQEHA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002036
RefSeq Size 1747
RefSeq ORF 714
Synonyms B-50; GAP-43; PP46
Locus ID 2596
UniProt ID P17677
Cytogenetics 3q13.31
Summary The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GAP43" proteins (3)
SKU Description Size Price
LC400750 Lyophilized GAP43 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400750 Transient overexpression lysate of growth associated protein 43 (GAP43), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303175 Recombinant protein of human growth associated protein 43 (GAP43), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products