GAP43 (NM_002045) Human Mass Spec Standard

CAT#: PH303175

GAP43 MS Standard C13 and N15-labeled recombinant protein (NP_002036)

Product Images

Coomassie blue staining of purified GAP43 protein (Cat# TP303175). The protein was produced from HEK293T cells transfected with GAP43 cDNA clone (Cat# RC203175) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203175
• Predicted MW: 24.8 kDa
• Protein Sequence:
  Sequence Link

  >RC203175 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKD
  EAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAET
  ESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIE
  AVDETKPKESARQDEGKEEEPEADQEHA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002036
• RefSeq Size: 1747
• RefSeq ORF: 714
• Synonyms: B-50; GAP-43; PP46
• Locus ID: 2596
• UniProt ID: P17677, Q5U058
• Cytogenetics: 3q13.31
• Summary: The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]