CES2 (NM_003869) Human Mass Spec Standard
CAT#: PH303009
CES2 MS Standard C13 and N15-labeled recombinant protein (NP_003860)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203009 |
Predicted MW | 68.9 kDa |
Protein Sequence |
>RC203009 protein sequence
Red=Cloning site Green=Tags(s) MTAQSRSPTTPTFPGPSQRTPLTPCPVQTPRLGKALIHCWTDPGQPLGEQQRVRRQRTETSEPTMRLHRL RARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLGIPFAKPPLGPLRFAPP EPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNLPVMVWI HGGALVFGMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFG GNPDRVTIFGESAGGTSVSSLVVSPISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSACDQVDSE ALVGCLRGKSKEEILAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRI YDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHF QCSRAPVYFYEFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFAR NGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHTEL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003860 |
RefSeq Size | 3955 |
RefSeq ORF | 1869 |
Synonyms | CE-2; CES2A1; iCE; PCE-2 |
Locus ID | 8824 |
UniProt ID | O00748 |
Cytogenetics | 16q22.1 |
Summary | This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. The protein encoded by this gene is the major intestinal enzyme and functions in intestine drug clearance. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Oct 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - other enzymes |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401274 | CES2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC405086 | CES2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY401274 | Transient overexpression lysate of carboxylesterase 2 (intestine, liver) (CES2), transcript variant 1 |
USD 436.00 |
|
LY405086 | Transient overexpression lysate of carboxylesterase 2 (intestine, liver) (CES2), transcript variant 2 |
USD 665.00 |
|
PH323021 | CES2 MS Standard C13 and N15-labeled recombinant protein (NP_932327) |
USD 3,255.00 |
|
TP303009 | Recombinant protein of human carboxylesterase 2 (intestine, liver) (CES2), transcript variant 1, 20 µg |
USD 867.00 |
|
TP323021 | Recombinant protein of human carboxylesterase 2 (intestine, liver) (CES2), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review