OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMEM79 (NM_032323) Human Mass Spec Standard

Be the first to review this product
SKU
PH302998
TMEM79 MS Standard C13 and N15-labeled recombinant protein (NP_115699)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA339608 Rabbit Polyclonal Anti-TMEM79 Antibody
100 ul
$585.00
LY410199 Transient overexpression lysate of transmembrane protein 79 (TMEM79), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TMEM79 or NM_032323"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202998
Predicted MW 43.5 kDa
Protein Sequence
Protein Sequence
>RC202998 protein sequence
Red=Cloning site Green=Tags(s)

MTEQETLALLEVKRSDSPEKSSPQALVPNGRQPEGEGGAESPGAESLRVGSSAGSPTAIEGAEDGLDSTV
SEAATLPWGTGPQPSAPFPDPPGWRDIEPEPPESEPLTKLEELPEDDANLLPEKAARAFVPIDLQCIERQ
PQEDLIVRCEAGEGECRTFMPPRVTHPDPTERKWAEAVVRPPGCSCGGCGSCGDREWLRAVASVGAALIL
FPCLLYGAYAFLPFDVPRLPTMSSRLIYTLRCGVFATFPIVLGILVYGLSLLCFSALRPFGEPRREVEIH
RRYVAQSVQLFILYFFNLAVLSTYLPQDTLKLLPLLTGLFAVSRLIYWLTFAVGRSFRGFGYGLTFLPLL
SMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115699
RefSeq Size 2215
RefSeq ORF 1182
Synonyms MATT
Locus ID 84283
UniProt ID Q9BSE2
Cytogenetics 1q22
Summary Contributes to the epidermal integrity and skin barrier function. Plays a role in the lamellar granule (LG) secretory system and in the stratum corneum (SC) epithelial cell formation (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMEM79" proteins (3)
SKU Description Size Price
LC410199 Lyophilized TMEM79 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410199 Transient overexpression lysate of transmembrane protein 79 (TMEM79), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302998 Recombinant protein of human transmembrane protein 79 (TMEM79), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products