OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NRIP3 (NM_020645) Human Mass Spec Standard

Be the first to review this product
SKU
PH302937
NRIP3 MS Standard C13 and N15-labeled recombinant protein (NP_065696)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504936 NRIP3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9) 100 ul
$447.00
LY412407 Transient overexpression lysate of nuclear receptor interacting protein 3 (NRIP3) (as WB positive control) 100 ug
$436.00

Other products for "NRIP3 or NM_020645"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202937
Predicted MW 27 kDa
Protein Sequence
Protein Sequence
>RC202937 protein sequence
Red=Cloning site Green=Tags(s)

MFYSGLLTEGGRKETDMREAASLRQQRRMKQAVQFIHKDSADLLPLDGLKKLGSSKDMQPHNILQRRLME
TNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVKALVDTGCLYNLISLACVDRL
GLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQTLRSLKCIINL
DKHRLIMGKTDKEEIPFVETVSLNEDNTSEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065696
RefSeq Size 3809
RefSeq ORF 723
Synonyms C11orf14; NY-SAR-105
Locus ID 56675
UniProt ID Q9NQ35
Cytogenetics 11p15.4
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NRIP3" proteins (3)
SKU Description Size Price
LC412407 Lyophilized NRIP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412407 Transient overexpression lysate of nuclear receptor interacting protein 3 (NRIP3) (as WB positive control) 100 ug
$436.00
TP302937 Recombinant protein of human nuclear receptor interacting protein 3 (NRIP3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products