NRIP3 (NM_020645) Human Recombinant Protein

SKU
TP302937
Recombinant protein of human nuclear receptor interacting protein 3 (NRIP3), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202937 protein sequence
Red=Cloning site Green=Tags(s)

MFYSGLLTEGGRKETDMREAASLRQQRRMKQAVQFIHKDSADLLPLDGLKKLGSSKDMQPHNILQRRLME
TNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVKALVDTGCLYNLISLACVDRL
GLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQTLRSLKCIINL
DKHRLIMGKTDKEEIPFVETVSLNEDNTSEA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_065696
Locus ID 56675
UniProt ID Q9NQ35
Cytogenetics 11p15.4
RefSeq Size 3809
RefSeq ORF 723
Synonyms C11orf14; NY-SAR-105
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:NRIP3 (NM_020645) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302937 NRIP3 MS Standard C13 and N15-labeled recombinant protein (NP_065696) 10 ug
$3,255.00
LC412407 NRIP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412407 Transient overexpression lysate of nuclear receptor interacting protein 3 (NRIP3) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.