OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PLTP (NM_182676) Human Mass Spec Standard

Be the first to review this product
SKU
PH302925
PLTP MS Standard C13 and N15-labeled recombinant protein (NP_872617)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY401875 Transient overexpression lysate of phospholipid transfer protein (PLTP), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PLTP or NM_182676"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202925
Predicted MW 49.3 kDa
Protein Sequence
Protein Sequence
>RC202925 protein sequence
Red=Cloning site Green=Tags(s)

MALFGALFLALLAGAHAEFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEVKV
TELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFLKVYDFLSTFITSGMRFLLNQQICPVLYHAG
TVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEER
MVYVAFSEFFFDSAMESYFRAGALQLLLVGDKVPHDLDMLLRATYFGSIVLLSPAVIDSPLKLELRVLAP
PRCTIKPSGTTISVTASVTIALVPPDQPEVQLSSMTMDARLSAKMALRGKALRTQLDLRRFRIYSNHSAL
ESLALIPLQAPLKTMLQIGVMPMLNERTWRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLREVI
EKNRPADVRASTAPTPSTAAV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_872617
RefSeq Size 1944
RefSeq ORF 1323
Synonyms BPIFE; HDLCQ9
Locus ID 5360
UniProt ID P55058
Cytogenetics 20q13.12
Summary The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL). In addition to regulating the size of HDL particles, this protein may be involved in cholesterol metabolism. At least two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Secreted Protein
Protein Pathways PPAR signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PLTP" proteins (7)
SKU Description Size Price
PH305797 PLTP MS Standard C13 and N15-labeled recombinant protein (NP_006218) 10 ug
$3,360.00
LC401875 Lyophilized PLTP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405442 Lyophilized PLTP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401875 Transient overexpression lysate of phospholipid transfer protein (PLTP), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY405442 Transient overexpression lysate of phospholipid transfer protein (PLTP), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302925 Recombinant protein of human phospholipid transfer protein (PLTP), transcript variant 2, 20 µg 20 ug
$737.00
TP305797 Recombinant protein of human phospholipid transfer protein (PLTP), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products