OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ING4 (NM_016162) Human Mass Spec Standard

Be the first to review this product
SKU
PH302827
ING4 MS Standard C13 and N15-labeled recombinant protein (NP_057246)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA319198 Anti-p29 ING4 (GOAT) Antibody, 100 ug
100 ug
$870.00
LY402512 Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "ING4 or NM_016162"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202827
Predicted MW 28.5 kDa
Protein Sequence
Protein Sequence
>RC202827 protein sequence
Red=Cloning site Green=Tags(s)

MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE
AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA
ARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMI
GCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057246
RefSeq Size 1458
RefSeq ORF 747
Synonyms my036; p29ING4
Locus ID 51147
UniProt ID Q9UNL4
Cytogenetics 12p13.31
Summary This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in the TP53-dependent regulatory pathway. Multiple alternatively spliced transcript variants have been observed that encode distinct proteins. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ING4" proteins (7)
SKU Description Size Price
PH325191 ING4 MS Standard C13 and N15-labeled recombinant protein (NP_001121058) 10 ug
$3,360.00
LC402512 Lyophilized ING4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426813 Lyophilized ING4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402512 Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426813 Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 6 (as WB positive control) 100 ug
$436.00
TP302827 Recombinant protein of human inhibitor of growth family, member 4 (ING4), transcript variant 1, 20 µg 20 ug
$737.00
TP325191 Purified recombinant protein of Homo sapiens inhibitor of growth family, member 4 (ING4), transcript variant 6, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products