ING4 (NM_001127586) Human Recombinant Protein

SKU
TP325191
Purified recombinant protein of Homo sapiens inhibitor of growth family, member 4 (ING4), transcript variant 6, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225191 representing NM_001127586
Red=Cloning site Green=Tags(s)

MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE
AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA
ARARSKGKNSDEEAPKTAQKKLKLVRTVPLSGSILPVWG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001121058
Locus ID 51147
UniProt ID Q9UNL4
Cytogenetics 12p13.31
RefSeq ORF 537
Synonyms my036; p29ING4
Summary This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in the TP53-dependent regulatory pathway. Multiple alternatively spliced transcript variants have been observed that encode distinct proteins. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:ING4 (NM_001127586) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302827 ING4 MS Standard C13 and N15-labeled recombinant protein (NP_057246) 10 ug
$3,255.00
PH325191 ING4 MS Standard C13 and N15-labeled recombinant protein (NP_001121058) 10 ug
$3,255.00
LC402512 ING4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426813 ING4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402512 Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 1 100 ug
$436.00
LY426813 Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 6 100 ug
$436.00
TP302827 Recombinant protein of human inhibitor of growth family, member 4 (ING4), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.