ING4 (NM_016162) Human Mass Spec Standard

SKU
PH302827
ING4 MS Standard C13 and N15-labeled recombinant protein (NP_057246)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202827]
Predicted MW 28.5 kDa
Protein Sequence
Protein Sequence
>RC202827 protein sequence
Red=Cloning site Green=Tags(s)

MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE
AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA
ARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMI
GCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057246
RefSeq Size 1458
RefSeq ORF 747
Synonyms my036; p29ING4
Locus ID 51147
UniProt ID Q9UNL4
Cytogenetics 12p13.31
Summary This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in the TP53-dependent regulatory pathway. Multiple alternatively spliced transcript variants have been observed that encode distinct proteins. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:ING4 (NM_016162) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH325191 ING4 MS Standard C13 and N15-labeled recombinant protein (NP_001121058) 10 ug
$3,255.00
LC402512 ING4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426813 ING4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402512 Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 1 100 ug
$436.00
LY426813 Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 6 100 ug
$436.00
TP302827 Recombinant protein of human inhibitor of growth family, member 4 (ING4), transcript variant 1, 20 µg 20 ug
$737.00
TP325191 Purified recombinant protein of Homo sapiens inhibitor of growth family, member 4 (ING4), transcript variant 6, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.