OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RFK (NM_018339) Human Mass Spec Standard

Be the first to review this product
SKU
PH302812
RFK MS Standard C13 and N15-labeled recombinant protein (NP_060809)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365293 RFK rabbit polyclonal antibody
100 ul
$310.00
LY413132 Transient overexpression lysate of riboflavin kinase (RFK) (as WB positive control) 100 ug
$436.00

Other products for "RFK or NM_018339"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202812
Predicted MW 18.4 kDa
Protein Sequence
Protein Sequence
>RC202812 protein sequence
Red=Cloning site Green=Tags(s)

MPRADCIMRHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVV
SIGWNPYYKNTKKSMETHIMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELP
EHLKIKEDNFFQVSKSKIMNGH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060809
RefSeq Size 2707
RefSeq ORF 486
Synonyms RIFK
Locus ID 55312
UniProt ID Q969G6
Cytogenetics 9q21.13
Summary Riboflavin kinase (RFK; EC 2.7.1.26) is an essential enzyme that catalyzes the phosphorylation of riboflavin (vitamin B2) to form flavin mononucleotide (FMN), an obligatory step in vitamin B2 utilization and flavin cofactor synthesis (Karthikeyan et al., 2003 PubMed 12623014).supplied by OMIM, Nov 2009
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Riboflavin metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RFK" proteins (3)
SKU Description Size Price
LC413132 Lyophilized RFK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413132 Transient overexpression lysate of riboflavin kinase (RFK) (as WB positive control) 100 ug
$436.00
TP302812 Recombinant protein of human riboflavin kinase (RFK), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products