OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CDK7 (NM_001799) Human Mass Spec Standard

Be the first to review this product
SKU
PH302736
CDK7 MS Standard C13 and N15-labeled recombinant protein (NP_001790)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY419742 Transient overexpression lysate of cyclin-dependent kinase 7 (CDK7) (as WB positive control) 100 ug
$436.00

Other products for "CDK7 or NM_001799"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202736
Predicted MW 39.1 kDa
Protein Sequence
Protein Sequence
>RC202736 protein sequence
Red=Cloning site Green=Tags(s)

MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELS
HPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHRHWILHRDLKP
NNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRV
PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNP
CARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001790
RefSeq Size 1534
RefSeq ORF 1038
Synonyms CAK; CAK1; CDKN7; HCAK; MO15; p39MO15; STK1
Locus ID 1022
UniProt ID P50613
Cytogenetics 5q13.2
Summary The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Protein Kinase, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Cell cycle, Nucleotide excision repair
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CDK7" proteins (3)
SKU Description Size Price
LC419742 Lyophilized CDK7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419742 Transient overexpression lysate of cyclin-dependent kinase 7 (CDK7) (as WB positive control) 100 ug
$436.00
TP302736 Recombinant protein of human cyclin-dependent kinase 7 (CDK7), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products