CDK7 (NM_001799) Human Tagged ORF Clone

SKU
RC202736
CDK7 (Myc-DDK-tagged)-Human cyclin-dependent kinase 7 (CDK7)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CDK7
Synonyms CAK; CAK1; CDKN7; HCAK; MO15; p39MO15; STK1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202736 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCTGGACGTGAAGTCTCGGGCAAAGCGTTATGAGAAGCTGGACTTCCTTGGGGAGGGACAGTTTG
CCACCGTTTACAAGGCCAGAGATAAGAACACCAACCAAATTGTCGCCATTAAGAAAATCAAACTTGGACA
TAGATCAGAAGCTAAAGATGGTATAAATAGAACCGCCTTAAGAGAGATAAAATTATTACAGGAGCTAAGT
CATCCAAATATAATTGGTCTCCTTGATGCTTTTGGACATAAATCTAATATTAGCCTTGTCTTTGATTTTA
TGGAAACTGATCTAGAGGTTATAATAAAGGATAATAGTCTTGTGCTGACACCATCACACATCAAAGCCTA
CATGTTGATGACTCTTCAAGGATTAGAATATTTACATCGACATTGGATCCTACATAGGGATCTGAAACCA
AACAACTTGTTGCTAGATGAAAATGGAGTTCTAAAACTGGCAGATTTTGGCCTGGCCAAATCTTTTGGGA
GCCCCAATAGAGCTTATACACATCAGGTTGTAACCAGGTGGTATCGGGCCCCCGAGTTACTATTTGGAGC
TAGGATGTATGGTGTAGGTGTGGACATGTGGGCTGTTGGCTGTATATTAGCAGAGTTACTTCTAAGGGTT
CCTTTTTTGCCAGGAGATTCAGACCTTGATCAGCTAACAAGAATATTTGAAACTTTGGGCACACCAACTG
AGGAACAGTGGCCGGACATGTGTAGTCTTCCAGATTATGTGACATTTAAGAGTTTCCCTGGAATACCTTT
GCATCACATCTTCAGTGCAGCAGGAGACGACTTACTAGATCTCATACAAGGCTTATTCTTATTTAATCCA
TGTGCTCGAATTACGGCCACACAGGCACTGAAAATGAAGTATTTCAGTAATCGGCCAGGGCCAACACCTG
GATGTCAGCTGCCAAGACCAAACTGTCCAGTGGAAACCTTAAAGGAGCAATCAAATCCAGCTTTGGCAAT
AAAAAGGAAAAGAACAGAGGCCTTAGAACAAGGAGGATTGCCCAAGAAACTAATTTTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202736 protein sequence
Red=Cloning site Green=Tags(s)

MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELS
HPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHRHWILHRDLKP
NNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRV
PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNP
CARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001799
ORF Size 1038 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001799.4
RefSeq Size 1534 bp
RefSeq ORF 1041 bp
Locus ID 1022
UniProt ID P50613
Cytogenetics 5q13.2
Domains pkinase, S_TKc, TyrKc
Protein Families Druggable Genome, Protein Kinase, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Cell cycle, Nucleotide excision repair
MW 39.1 kDa
Summary The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CDK7 (NM_001799) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202736L1 Lenti ORF clone of Human cyclin-dependent kinase 7 (CDK7), Myc-DDK-tagged 10 ug
$986.00
RC202736L2 Lenti ORF clone of Human cyclin-dependent kinase 7 (CDK7), mGFP tagged 10 ug
$986.00
RC202736L3 Lenti ORF clone of Human cyclin-dependent kinase 7 (CDK7), Myc-DDK-tagged 10 ug
$986.00
RC202736L4 Lenti ORF clone of Human cyclin-dependent kinase 7 (CDK7), mGFP tagged 10 ug
$986.00
RG202736 CDK7 (tGFP-tagged) - Human cyclin-dependent kinase 7 (CDK7) 10 ug
$489.00 MSRP $886.00 MSRP $886.00
SC119024 CDK7 (untagged)-Human cyclin-dependent kinase 7 (CDK7) 10 ug
$686.00
SC323465 CDK7 (untagged)-Kinase deficient mutant (K41M) of Human cyclin-dependent kinase 7 (CDK7) 10 ug
$686.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.